General Information

  • ID:  hor005343
  • Uniprot ID:  P41967
  • Protein name:  Neuropeptide F (NPF)
  • Gene name:  NA
  • Organism:  Moniezia expansa (Sheep tapeworm)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Moniezia (genus), Anoplocephalidae (family), Cyclophyllidea (order), Eucestoda (subclass), Cestoda (class), Platyhelminthes (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF
  • Length:  39
  • Propeptide:  PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF
  • Signal peptide:  NA
  • Modification:  T39 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have an important physiological role in neuroregulation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  1K8V(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1k8v.pdbhor005343_AF2.pdbhor005343_ESM.pdb

Physical Information

Mass: 527225 Formula: C210H327N57O59
Absent amino acids: CHMTW Common amino acids: D
pI: 6.66 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 16
Hydrophobicity: -35.9 Boman Index: -8758
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 102.56
Instability Index: 2961.54 Extinction Coefficient cystines: 2980
Absorbance 280nm: 78.42

Literature

  • PubMed ID:  1461689
  • Title:  Neuropeptide F (Moniezia expansa): localization and characterization using specific antisera.
  • PubMed ID:  12023801
  • Title:  The NMR-derived conformation of neuropeptide F from Moniezia expansa.